Lineage for d3g7fh1 (3g7f H:1-36)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577985Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2578573Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (2 families) (S)
  5. 2578693Family f.23.10.0: automated matches [227192] (1 protein)
    not a true family
  6. 2578694Protein automated matches [226917] (3 species)
    not a true protein
  7. 2578695Species Blastochloris viridis [TaxId:1079] [232250] (5 PDB entries)
  8. 2578697Domain d3g7fh1: 3g7f H:1-36 [232251]
    Other proteins in same PDB: d3g7fc_, d3g7fh2, d3g7fl_, d3g7fm_
    automated match to d1dxrh2
    complexed with bcb, bpb, fe2, hec, hto, lda, mq9, ns5, so4, uq1; mutant

Details for d3g7fh1

PDB Entry: 3g7f (more details), 2.5 Å

PDB Description: Crystal structure of Blastochloris viridis heterodimer mutant reaction center
PDB Compounds: (H:) Photosynthetic reaction center H subunit

SCOPe Domain Sequences for d3g7fh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g7fh1 f.23.10.0 (H:1-36) automated matches {Blastochloris viridis [TaxId: 1079]}
myhgalaqhldiaqlvwyaqwlviwtvvllylrred

SCOPe Domain Coordinates for d3g7fh1:

Click to download the PDB-style file with coordinates for d3g7fh1.
(The format of our PDB-style files is described here.)

Timeline for d3g7fh1: