Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (64 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [224896] (72 PDB entries) |
Domain d3fzha2: 3fzh A:189-381 [232216] Other proteins in same PDB: d3fzhb1, d3fzhb2 automated match to d3l6qa2 complexed with 3bh |
PDB Entry: 3fzh (more details), 2 Å
SCOPe Domain Sequences for d3fzha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fzha2 c.55.1.0 (A:189-381) automated matches {Human (Homo sapiens) [TaxId: 9606]} vgaernvlifdlgggtfdvsiltiedgifevkstagdthlggedfdnrmvnhfiaefkrk hkkdisenkravrrlrtacerakrtlssstqasieidslyegidfytsitrarfeelnad lfrgtldpvekalrdakldksqihdivlvggstripkiqkllqdffngkelnksinpdea vaygaavqaails
Timeline for d3fzha2: