SCOPe 2.03: Domain d3fyeb1: 3fye B:30-129

Lineage for d3fyeb1 (3fye B:30-129)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (5 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families)

5. Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)

6. Protein Bacterial aa3 type cytochrome c oxidase subunit II [81458] (2 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81457] (5 PDB entries)

8. Domain d3fyeb1: 3fye B:30-129 [232210]
   Other proteins in same PDB: d3fyea_, d3fyeb2, d3fyec_
   automated match to d3dtub2
   complexed with ca, cd, cu1, dmu, hea, hto, mg, trd, unx

Details for d3fyeb1

PDB Entry: 3fye, 2.15 Å

PDB Description: catalytic core subunits (i and ii) of cytochrome c oxidase from rhodobacter sphaeroides in the reduced state

PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3fyeb1:

Sequence; same for both SEQRES and ATOM records:

>d3fyeb1 f.17.2.1 (B:30-129) Bacterial aa3 type cytochrome c oxidase subunit II {Rhodobacter sphaeroides [TaxId: 1063]}
leiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhekrnk
vparfthnspleiawtivpivilvaigafslpvlfnqqei

Timeline for d3fyeb1:

• d3fyeb1 is new in SCOPe 2.03-stable
  
• d3fyeb1 appears in SCOPe 2.04
  
• d3fyeb1 appears in the current release, SCOPe 2.08