SCOPe 2.08: Domain d3fm1a_: 3fm1 A:

Lineage for d3fm1a_ (3fm1 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.0: automated matches [191605] (1 protein)
   not a true family

6. Protein automated matches [191104] (14 species)
   not a true protein

7. Species Pleurotus eryngii [TaxId:5323] [226503] (19 PDB entries)

8. Domain d3fm1a_: 3fm1 A: [232171]
   automated match to d4fcna_
   complexed with ca, fe, hem, mn, na, zn

Details for d3fm1a_

PDB Entry: 3fm1, 1.78 Å

PDB Description: Crystal Structure Analysis of Fungal Versatile Peroxidase from Pleurotus eryngii

PDB Compounds: (A:) versatile peroxidase vpl2

SCOPe Domain Sequences for d3fm1a_:

Sequence; same for both SEQRES and ATOM records:

>d3fm1a_ a.93.1.0 (A:) automated matches {Pleurotus eryngii [TaxId: 5323]}
atcddgrttanaaccilfpilddiqenlfdgaqcgeevheslrltfhdaigfsptlgggg
adgsiiafdtietnfpanagideivsaqkpfvakhnisagdfiqfagavgvsncpggvri
pfflgrpdavaaspdhlvpepfdsvdsilarmgdagfspvevvwllashsiaaadkvdps
ipgtpfdstpqvfdsqffietqlkgrlfpgtadnkgeaqsplqgeirlqsdhllardpqt
acewqsmvnnqpkiqnrfaatmskmallgqdktklidcsdviptppalvgaahlpagfsl
sdveqacaatpfpaltadp

Timeline for d3fm1a_:

• d3fm1a_ first appeared in SCOPe 2.03
  
• d3fm1a_ appears in SCOPe 2.07