SCOPe 2.06: Domain d3fdba1: 3fdb A:1-376

Lineage for d3fdba1 (3fdb A:1-376)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (121 species)
   not a true protein

7. Species Corynebacterium diphtheriae [TaxId:1717] [232157] (1 PDB entry)

8. Domain d3fdba1: 3fdb A:1-376 [232158]
   Other proteins in same PDB: d3fdba2
   automated match to d4dgta_
   complexed with cl, edo, na

Details for d3fdba1

PDB Entry: 3fdb, 1.99 Å

PDB Description: crystal structure of a putative plp-dependent beta-cystathionase (aecd, dip1736) from corynebacterium diphtheriae at 1.99 a resolution

PDB Compounds: (A:) putative PLP-dependent beta-cystathionase

SCOPe Domain Sequences for d3fdba1:

Sequence; same for both SEQRES and ATOM records:

>d3fdba1 c.67.1.0 (A:1-376) automated matches {Corynebacterium diphtheriae [TaxId: 1717]}
mqfpsiedlrarntmkwtrygqgvlplwvaesdfstcpavlqaitdavqreafgyqpdgs
llsqataefyadrygyqarpewifpipdvvrglyiaidhftpaqskvivptpayppffhl
lsatqregifidatgginlhdvekgfqagarsillcnpynplgmvfapewlnelcdlahr
ydarvlvdeihaplvfdgqhtvaagvsdtaasvcititapskawniaglkcaqiifsnps
daehwqqlspvikdgastlgliaaeaayrygtdflnqevaylknnhdfllheipkripga
kitpmqatylmwidfrdttiegspseffiekakvamndgawfgedgtgfcrlnfatsrev
leeaidrmakavshht

Timeline for d3fdba1:

• d3fdba1 first appeared in SCOPe 2.03, called d3fdba_
  
• d3fdba1 was called d3fdba_ in SCOPe 2.05
  
• d3fdba1 appears in SCOPe 2.07
  
• d3fdba1 appears in the current release, SCOPe 2.08