Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (121 species) not a true protein |
Species Corynebacterium diphtheriae [TaxId:1717] [232157] (1 PDB entry) |
Domain d3fdba1: 3fdb A:1-376 [232158] Other proteins in same PDB: d3fdba2 automated match to d4dgta_ complexed with cl, edo, na |
PDB Entry: 3fdb (more details), 1.99 Å
SCOPe Domain Sequences for d3fdba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fdba1 c.67.1.0 (A:1-376) automated matches {Corynebacterium diphtheriae [TaxId: 1717]} mqfpsiedlrarntmkwtrygqgvlplwvaesdfstcpavlqaitdavqreafgyqpdgs llsqataefyadrygyqarpewifpipdvvrglyiaidhftpaqskvivptpayppffhl lsatqregifidatgginlhdvekgfqagarsillcnpynplgmvfapewlnelcdlahr ydarvlvdeihaplvfdgqhtvaagvsdtaasvcititapskawniaglkcaqiifsnps daehwqqlspvikdgastlgliaaeaayrygtdflnqevaylknnhdfllheipkripga kitpmqatylmwidfrdttiegspseffiekakvamndgawfgedgtgfcrlnfatsrev leeaidrmakavshht
Timeline for d3fdba1: