Lineage for d3fdba_ (3fdb A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1866060Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1866061Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1867290Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 1867291Protein automated matches [190151] (98 species)
    not a true protein
  7. 1867489Species Corynebacterium diphtheriae [TaxId:1717] [232157] (1 PDB entry)
  8. 1867490Domain d3fdba_: 3fdb A: [232158]
    automated match to d4dgta_
    complexed with cl, edo, na

Details for d3fdba_

PDB Entry: 3fdb (more details), 1.99 Å

PDB Description: crystal structure of a putative plp-dependent beta-cystathionase (aecd, dip1736) from corynebacterium diphtheriae at 1.99 a resolution
PDB Compounds: (A:) putative PLP-dependent beta-cystathionase

SCOPe Domain Sequences for d3fdba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fdba_ c.67.1.0 (A:) automated matches {Corynebacterium diphtheriae [TaxId: 1717]}
gmqfpsiedlrarntmkwtrygqgvlplwvaesdfstcpavlqaitdavqreafgyqpdg
sllsqataefyadrygyqarpewifpipdvvrglyiaidhftpaqskvivptpayppffh
llsatqregifidatgginlhdvekgfqagarsillcnpynplgmvfapewlnelcdlah
rydarvlvdeihaplvfdgqhtvaagvsdtaasvcititapskawniaglkcaqiifsnp
sdaehwqqlspvikdgastlgliaaeaayrygtdflnqevaylknnhdfllheipkripg
akitpmqatylmwidfrdttiegspseffiekakvamndgawfgedgtgfcrlnfatsre
vleeaidrmakavshht

SCOPe Domain Coordinates for d3fdba_:

Click to download the PDB-style file with coordinates for d3fdba_.
(The format of our PDB-style files is described here.)

Timeline for d3fdba_: