SCOPe 2.04: Domain d3f5xd1: 3f5x D:178-309

Lineage for d3f5xd1 (3f5x D:178-309)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (74 PDB entries)
   Uniprot P20248 175-432

8. Domain d3f5xd1: 3f5x D:178-309 [232144]
   Other proteins in same PDB: d3f5xa_, d3f5xc_
   automated match to d1finb1
   complexed with ezv, gol, so4

Details for d3f5xd1

PDB Entry: 3f5x, 2.4 Å

PDB Description: CDK-2-Cyclin complex with indazole inhibitor 9 bound at its active site

PDB Compounds: (D:) Cyclin-A2

SCOPe Domain Sequences for d3f5xd1:

Sequence; same for both SEQRES and ATOM records:

>d3f5xd1 a.74.1.1 (D:178-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
yhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavn
yidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehl
vlkvltfdlaap

Timeline for d3f5xd1:

• d3f5xd1 first appeared in SCOPe 2.03
  
• d3f5xd1 appears in SCOPe 2.05
  
• d3f5xd1 appears in the current release, SCOPe 2.08