Lineage for d3ez5d2 (3ez5 D:469-876)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1451898Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 1451899Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 1451900Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
  6. 1451901Protein DNA polymerase I (Klenow fragment) [56674] (3 species)
  7. 1451902Species Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId:1422] [56677] (44 PDB entries)
    Uniprot Q5KWC1 299-878 # 99% sequence identity; Geobacillus kaustophilus TaxID:1462
    Uniprot Q45458 298-876 # 88% sequence identity
  8. 1451925Domain d3ez5d2: 3ez5 D:469-876 [232132]
    Other proteins in same PDB: d3ez5a1, d3ez5d1
    automated match to d2hvia2
    protein/DNA complex; complexed with dad, so4, suc, zn

Details for d3ez5d2

PDB Entry: 3ez5 (more details), 1.9 Å

PDB Description: cocrystal structure of bacillus fragment dna polymerase i with duplex dna , dctp, and zinc (closed form).
PDB Compounds: (D:) DNA polymerase I

SCOPe Domain Sequences for d3ez5d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ez5d2 e.8.1.1 (D:469-876) DNA polymerase I (Klenow fragment) {Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId: 1422]}
eqdrllveleqplssilaemefagvkvdtkrleqmgkelaeqlgtveqriyelagqefni
nspkqlgvilfeklqlpvlkktktgystsadvleklapyheivenilhyrqlgklqstyi
egllkvvrpatkkvhtifnqaltqtgrlsstepnlqnipirleegrkirqafvpsesdwl
ifaadysqielrvlahiaeddnlmeafrrdldihtktamdifqvsedevtpnmrrqakav
nygivygisdyglaqnlnisrkeaaefieryfesfpgvkrymenivqeakqkgyvttllh
rrrylpditsrnfnvrsfaermamntpiqgsaadiikkamidlnarlkeerlqahlllqv
hdelileapkeemerlcrlvpevmeqavtlrvplkvdyhygstwydak

SCOPe Domain Coordinates for d3ez5d2:

Click to download the PDB-style file with coordinates for d3ez5d2.
(The format of our PDB-style files is described here.)

Timeline for d3ez5d2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ez5d1