Lineage for d3eub22 (3eub 2:93-165)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1493241Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 1493242Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) (S)
    contains 2Fe-2S cluster
  5. 1493243Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (7 proteins)
  6. 1493321Protein automated matches [232101] (1 species)
    not a true protein
  7. 1493322Species Cow (Bos taurus) [TaxId:9913] [232106] (9 PDB entries)
  8. 1493337Domain d3eub22: 3eub 2:93-165 [232116]
    Other proteins in same PDB: d3eub21, d3eub31, d3eub32, d3eub41, d3eub42, d3euba1, d3eubb1, d3eubb2, d3eubc1, d3eubc2, d3eubj1, d3eubk1, d3eubk2, d3eubl1, d3eubl2, d3eubs1, d3eubt1, d3eubt2, d3eubu1, d3eubu2
    automated match to d1v97a1
    complexed with fad, fes, mom, mte, xan

Details for d3eub22

PDB Entry: 3eub (more details), 2.6 Å

PDB Description: Crystal Structure of Desulfo-Xanthine Oxidase with Xanthine
PDB Compounds: (2:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3eub22:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eub22 a.56.1.1 (2:93-165) automated matches {Cow (Bos taurus) [TaxId: 9913]}
stktrlhpvqeriakshgsqcgfctpgivmsmytllrnqpeptveeiedafqgnlcrctg
yrpilqgfrtfak

SCOPe Domain Coordinates for d3eub22:

Click to download the PDB-style file with coordinates for d3eub22.
(The format of our PDB-style files is described here.)

Timeline for d3eub22: