SCOPe 2.03: Domain d3euba2: 3eub A:93-165

Lineage for d3euba2 (3eub A:93-165)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
   core: 4 helices, bundle

4. Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families)
   contains 2Fe-2S cluster

5. Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (7 proteins)

6. Protein automated matches [232101] (1 species)
   not a true protein
7. Species Bos taurus [TaxId:9913] [232106] (2 PDB entries)

8. Domain d3euba2: 3eub A:93-165 [232108]
   Other proteins in same PDB: d3eub31, d3eub32, d3euba1
   automated match to d1v97a1

Details for d3euba2

PDB Entry: 3eub, 2.6 Å

PDB Description: Crystal Structure of Desulfo-Xanthine Oxidase with Xanthine

PDB Compounds: (A:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3euba2:

Sequence; same for both SEQRES and ATOM records:

>d3euba2 a.56.1.1 (A:93-165) automated matches {Bos taurus [TaxId: 9913]}
stktrlhpvqeriakshgsqcgfctpgivmsmytllrnqpeptveeiedafqgnlcrctg
yrpilqgfrtfak

Timeline for d3euba2:

• d3euba2 is new in SCOPe 2.03-stable
  
• d3euba2 appears in SCOPe 2.04
  
• d3euba2 appears in the current release, SCOPe 2.08