SCOPe 2.03: Domain d3etrb2: 3etr B:415-528

Lineage for d3etrb2 (3etr B:415-528)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
   core: beta(3,4)-alpha(3); alpha+beta sandwich

4. Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families)
   automatically mapped to Pfam PF03450

5. Family d.87.2.0: automated matches [232089] (1 protein)
   not a true family
6. Protein automated matches [232090] (1 species)
   not a true protein
7. Species Bos taurus [TaxId:9913] [232091] (3 PDB entries)

8. Domain d3etrb2: 3etr B:415-528 [232100]
   Other proteins in same PDB: d3etrb1, d3etrc1, d3etrc2, d3etrl1, d3etrl2, d3etrm1
   automated match to d1v97a4
   complexed with ca, fad, fes, luz, mos, mte

Details for d3etrb2

PDB Entry: 3etr, 2.2 Å

PDB Description: crystal structure of xanthine oxidase in complex with lumazine

PDB Compounds: (B:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3etrb2:

Sequence; same for both SEQRES and ATOM records:

>d3etrb2 d.87.2.0 (B:415-528) automated matches {Bos taurus [TaxId: 9913]}
deffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkql
skfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklg

Timeline for d3etrb2:

• d3etrb2 is new in SCOPe 2.03-stable
  
• d3etrb2 appears in SCOPe 2.04
  
• d3etrb2 appears in the current release, SCOPe 2.08