SCOPe 2.03: Domain d3eub32: 3eub 3:415-528

Lineage for d3eub32 (3eub 3:415-528)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
   core: beta(3,4)-alpha(3); alpha+beta sandwich

4. Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families)
   automatically mapped to Pfam PF03450

5. Family d.87.2.0: automated matches [232089] (1 protein)
   not a true family
6. Protein automated matches [232090] (1 species)
   not a true protein
7. Species Bos taurus [TaxId:9913] [232091] (3 PDB entries)

8. Domain d3eub32: 3eub 3:415-528 [232092]
   Other proteins in same PDB: d3eub31, d3euba1, d3euba2
   automated match to d1v97a4

Details for d3eub32

PDB Entry: 3eub, 2.6 Å

PDB Description: Crystal Structure of Desulfo-Xanthine Oxidase with Xanthine

PDB Compounds: (3:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3eub32:

Sequence; same for both SEQRES and ATOM records:

>d3eub32 d.87.2.0 (3:415-528) automated matches {Bos taurus [TaxId: 9913]}
deffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkql
skfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklg

Timeline for d3eub32:

• d3eub32 is new in SCOPe 2.03-stable
  
• d3eub32 appears in SCOPe 2.04
  
• d3eub32 appears in the current release, SCOPe 2.08