SCOPe 2.03: Domain d3euba1: 3eub A:4-92

Lineage for d3euba1 (3eub A:4-92)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)

6. Protein automated matches [231466] (2 species)
   not a true protein

7. Species Bos taurus [TaxId:9913] [232069] (2 PDB entries)

8. Domain d3euba1: 3eub A:4-92 [232081]
   Other proteins in same PDB: d3eub31, d3eub32, d3euba2
   automated match to d1fiqa2
   complexed with fad, fes, mom, mte, xan

Details for d3euba1

PDB Entry: 3eub, 2.6 Å

PDB Description: Crystal Structure of Desulfo-Xanthine Oxidase with Xanthine

PDB Compounds: (A:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3euba1:

Sequence; same for both SEQRES and ATOM records:

>d3euba1 d.15.4.2 (A:4-92) automated matches {Bos taurus [TaxId: 9913]}
delvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrlqd
kiihfsanaclapictlhhvavttvegig

Timeline for d3euba1:

• d3euba1 is new in SCOPe 2.03-stable
  
• d3euba1 appears in SCOPe 2.04
  
• d3euba1 appears in the current release, SCOPe 2.08