SCOPe 2.03: Domain d3eub41: 3eub 4:571-694

Lineage for d3eub41 (3eub 4:571-694)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
   core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids

4. Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families)

5. Family d.41.1.0: automated matches [230464] (1 protein)
   not a true family

6. Protein automated matches [230465] (2 species)
   not a true protein

7. Species Bos taurus [TaxId:9913] [232071] (4 PDB entries)

8. Domain d3eub41: 3eub 4:571-694 [232080]
   Other proteins in same PDB: d3eub21, d3eub22, d3eub42, d3eubb1, d3eubb2, d3eubc2
   automated match to d1v97a3
   complexed with fad, fes, mom, mte, xan

Details for d3eub41

PDB Entry: 3eub, 2.6 Å

PDB Description: Crystal Structure of Desulfo-Xanthine Oxidase with Xanthine

PDB Compounds: (4:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3eub41:

Sequence; same for both SEQRES and ATOM records:

>d3eub41 d.41.1.0 (4:571-694) automated matches {Bos taurus [TaxId: 9913]}
dtvgrplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpg
fvcflsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtye
dlpa

Timeline for d3eub41:

• d3eub41 is new in SCOPe 2.03-stable
  
• d3eub41 appears in SCOPe 2.04
  
• d3eub41 appears in the current release, SCOPe 2.08