![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
![]() | Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families) ![]() |
![]() | Family d.41.1.0: automated matches [230464] (1 protein) not a true family |
![]() | Protein automated matches [230465] (2 species) not a true protein |
![]() | Species Bos taurus [TaxId:9913] [232071] (4 PDB entries) |
![]() | Domain d3eub41: 3eub 4:571-694 [232080] Other proteins in same PDB: d3eub21, d3eub22, d3eub42, d3eubb1, d3eubb2, d3eubc2 automated match to d1v97a3 complexed with fad, fes, mom, mte, xan |
PDB Entry: 3eub (more details), 2.6 Å
SCOPe Domain Sequences for d3eub41:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eub41 d.41.1.0 (4:571-694) automated matches {Bos taurus [TaxId: 9913]} dtvgrplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpg fvcflsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtye dlpa
Timeline for d3eub41: