Lineage for d3eub41 (3eub 4:571-694)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2944850Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2944851Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families) (S)
  5. 2944937Family d.41.1.0: automated matches [230464] (1 protein)
    not a true family
  6. 2944938Protein automated matches [230465] (4 species)
    not a true protein
  7. 2944939Species Cow (Bos taurus) [TaxId:9913] [232071] (10 PDB entries)
  8. 2944958Domain d3eub41: 3eub 4:571-694 [232080]
    Other proteins in same PDB: d3eub21, d3eub22, d3eub31, d3eub32, d3eub42, d3euba1, d3euba2, d3eubb1, d3eubb2, d3eubc2, d3eubj1, d3eubj2, d3eubk1, d3eubk2, d3eubl2, d3eubs1, d3eubs2, d3eubt1, d3eubt2, d3eubu2
    automated match to d1v97a3
    complexed with fad, fes, mom, mte, xan

Details for d3eub41

PDB Entry: 3eub (more details), 2.6 Å

PDB Description: Crystal Structure of Desulfo-Xanthine Oxidase with Xanthine
PDB Compounds: (4:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3eub41:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eub41 d.41.1.0 (4:571-694) automated matches {Cow (Bos taurus) [TaxId: 9913]}
dtvgrplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpg
fvcflsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtye
dlpa

SCOPe Domain Coordinates for d3eub41:

Click to download the PDB-style file with coordinates for d3eub41.
(The format of our PDB-style files is described here.)

Timeline for d3eub41: