SCOPe 2.03: Domain d3eub31: 3eub 3:224-414

Lineage for d3eub31 (3eub 3:224-414)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
   consists of two alpha+beta subdomains

4. Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families)

5. Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (6 proteins)
   automatically mapped to Pfam PF00941

6. Protein automated matches [232070] (1 species)
   not a true protein

7. Species Bos taurus [TaxId:9913] [232074] (3 PDB entries)

8. Domain d3eub31: 3eub 3:224-414 [232079]
   Other proteins in same PDB: d3eub32, d3euba1, d3euba2
   automated match to d3b9jb2
   complexed with fad, fes, mom, mte, xan

Details for d3eub31

PDB Entry: 3eub, 2.6 Å

PDB Description: Crystal Structure of Desulfo-Xanthine Oxidase with Xanthine

PDB Compounds: (3:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3eub31:

Sequence; same for both SEQRES and ATOM records:

>d3eub31 d.145.1.3 (3:224-414) automated matches {Bos taurus [TaxId: 9913]}
pkqlrfegervtwiqastlkelldlkaqhpeaklvvgnteigiemkfknqlfpmiicpaw
ipelnavehgpegisfgaacalssvektlleavaklptqktevfrgvleqlrwfagkqvk
svaslggniitaspisdlnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllgpeei
llsieipysre

Timeline for d3eub31:

• d3eub31 is new in SCOPe 2.03-stable
  
• d3eub31 appears in SCOPe 2.04
  
• d3eub31 appears in the current release, SCOPe 2.08