SCOPe 2.03: Domain d3eub21: 3eub 2:2-92

Lineage for d3eub21 (3eub 2:2-92)

Root: SCOPe 2.03
Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)
Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
Protein automated matches [231466] (2 species)
not a true protein
Species Bos taurus [TaxId:9913] [232069] (2 PDB entries)
Domain d3eub21: 3eub 2:2-92 [232078]
Other proteins in same PDB: d3eub22, d3eub41, d3eub42, d3eubb1, d3eubb2, d3eubc1, d3eubc2
automated match to d1fiqa2
complexed with fad, fes, mom, mte, xan

Details for d3eub21

PDB Entry: 3eub (more details), 2.6 Å

PDB Description: Crystal Structure of Desulfo-Xanthine Oxidase with Xanthine

PDB Compounds: (2:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3eub21:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eub21 d.15.4.2 (2:2-92) automated matches {Bos taurus [TaxId: 9913]}
tadelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrl
qdkiihfsanaclapictlhhvavttvegig

SCOPe Domain Coordinates for d3eub21:

Click to download the PDB-style file with coordinates for d3eub21.
(The format of our PDB-style files is described here.)

Timeline for d3eub21: