Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily) consists of two alpha+beta subdomains |
Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) |
Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (6 proteins) automatically mapped to Pfam PF00941 |
Protein automated matches [232070] (2 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [232074] (11 PDB entries) |
Domain d3etrm1: 3etr M:224-414 [232076] Other proteins in same PDB: d3etra1, d3etra2, d3etrb2, d3etrc1, d3etrc2, d3etrl1, d3etrl2, d3etrm2, d3etrn1, d3etrn2 automated match to d3b9jb2 complexed with ca, fad, fes, luz, mos, mte |
PDB Entry: 3etr (more details), 2.2 Å
SCOPe Domain Sequences for d3etrm1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3etrm1 d.145.1.3 (M:224-414) automated matches {Cow (Bos taurus) [TaxId: 9913]} pkqlrfegervtwiqastlkelldlkaqhpeaklvvgnteigiemkfknqlfpmiicpaw ipelnavehgpegisfgaacalssvektlleavaklptqktevfrgvleqlrwfagkqvk svaslggniitaspisdlnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllgpeei llsieipysre
Timeline for d3etrm1: