SCOPe 2.05: Domain d3e6mc_: 3e6m C:

Lineage for d3e6mc_ (3e6m C:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (57 species)
   not a true protein

7. Species Silicibacter pomeroyi [TaxId:246200] [225430] (2 PDB entries)

8. Domain d3e6mc_: 3e6m C: [232051]
   automated match to d3cjna_

Details for d3e6mc_

PDB Entry: 3e6m, 2.2 Å

PDB Description: The crystal structure of a MarR family transcriptional regulator from Silicibacter pomeroyi DSS.

PDB Compounds: (C:) MarR family Transcriptional regulator

SCOPe Domain Sequences for d3e6mc_:

Sequence, based on SEQRES records:

>d3e6mc_ a.4.5.0 (C:) automated matches {Silicibacter pomeroyi [TaxId: 246200]}
pkpsfpygspgelnsflpylltrithiwsselnqalaseklptpklrllsslsaygeltv
gqlatlgvmeqsttsrtvdqlvdeglaarsisdadqrkrtvvltrkgkkklaeisplind
fhaelvgnvdpdklqtcievlgeilkgkt

Sequence, based on observed residues (ATOM records):

>d3e6mc_ a.4.5.0 (C:) automated matches {Silicibacter pomeroyi [TaxId: 246200]}
pkpsfpygspgelnsflpylltrithiwsselnqalaseklptpklrllsslsaygeltv
gqlatlgvmeqsttsrtvdqlvdeglaarsisdrkrtvvltrkgkkklaeisplindfha
elvgnvdpdklqtcievlgeilkgkt

Timeline for d3e6mc_:

• d3e6mc_ first appeared in SCOPe 2.03
  
• d3e6mc_ appears in SCOPe 2.04
  
• d3e6mc_ appears in SCOPe 2.06
  
• d3e6mc_ appears in the current release, SCOPe 2.08