Lineage for d3e6mc_ (3e6m C:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1478534Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1479947Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1479948Protein automated matches [190154] (52 species)
    not a true protein
  7. 1480200Species Silicibacter pomeroyi [TaxId:246200] [225430] (2 PDB entries)
  8. 1480203Domain d3e6mc_: 3e6m C: [232051]
    automated match to d3cjna_

Details for d3e6mc_

PDB Entry: 3e6m (more details), 2.2 Å

PDB Description: The crystal structure of a MarR family transcriptional regulator from Silicibacter pomeroyi DSS.
PDB Compounds: (C:) MarR family Transcriptional regulator

SCOPe Domain Sequences for d3e6mc_:

Sequence, based on SEQRES records: (download)

>d3e6mc_ a.4.5.0 (C:) automated matches {Silicibacter pomeroyi [TaxId: 246200]}
pkpsfpygspgelnsflpylltrithiwsselnqalaseklptpklrllsslsaygeltv
gqlatlgvmeqsttsrtvdqlvdeglaarsisdadqrkrtvvltrkgkkklaeisplind
fhaelvgnvdpdklqtcievlgeilkgkt

Sequence, based on observed residues (ATOM records): (download)

>d3e6mc_ a.4.5.0 (C:) automated matches {Silicibacter pomeroyi [TaxId: 246200]}
pkpsfpygspgelnsflpylltrithiwsselnqalaseklptpklrllsslsaygeltv
gqlatlgvmeqsttsrtvdqlvdeglaarsisdrkrtvvltrkgkkklaeisplindfha
elvgnvdpdklqtcievlgeilkgkt

SCOPe Domain Coordinates for d3e6mc_:

Click to download the PDB-style file with coordinates for d3e6mc_.
(The format of our PDB-style files is described here.)

Timeline for d3e6mc_: