Lineage for d1pdka2 (1pdk A:125-215)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11282Fold b.7: C2 domain-like [49561] (4 superfamilies)
  4. 11348Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (1 family) (S)
  5. 11349Family b.7.2.1: Periplasmic chaperone C-domain [49585] (2 proteins)
  6. 11361Protein PapD [49586] (1 species)
  7. 11362Species Escherichia coli [TaxId:562] [49587] (4 PDB entries)
  8. 11367Domain d1pdka2: 1pdk A:125-215 [23204]
    Other proteins in same PDB: d1pdka1, d1pdkb_

Details for d1pdka2

PDB Entry: 1pdk (more details), 2.4 Å

PDB Description: papd-papk chaperone-pilus subunit complex from e.coli p pilus

SCOP Domain Sequences for d1pdka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pdka2 b.7.2.1 (A:125-215) PapD {Escherichia coli}
nevwqdqlilnkvsggyrienptpyyvtviglggsekqaeegefetvmlsprseqtvksa
nyntpylsyindyggrpvlsficngsrcsvk

SCOP Domain Coordinates for d1pdka2:

Click to download the PDB-style file with coordinates for d1pdka2.
(The format of our PDB-style files is described here.)

Timeline for d1pdka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pdka1
View in 3D
Domains from other chains:
(mouse over for more information)
d1pdkb_