Lineage for d3dtga_ (3dtg A:)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1453426Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
    2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8
  4. 1453427Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) (S)
  5. 1453510Family e.17.1.0: automated matches [191499] (1 protein)
    not a true family
  6. 1453511Protein automated matches [190815] (7 species)
    not a true protein
  7. 1453519Species Mycobacterium smegmatis [TaxId:1772] [232037] (1 PDB entry)
  8. 1453520Domain d3dtga_: 3dtg A: [232038]
    automated match to d2coib_
    complexed with gol, obz, plp

Details for d3dtga_

PDB Entry: 3dtg (more details), 1.9 Å

PDB Description: structural analysis of mycobacterial branched chain aminotransferase- implications for inhibitor design
PDB Compounds: (A:) branched-chain amino acid aminotransferase

SCOPe Domain Sequences for d3dtga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dtga_ e.17.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 1772]}
leftvsantnpatdavresilanpgfgkyytdhmvsidytvdegwhnaqvipygpiqldp
saivlhygqeifeglkayrwadgsivsfrpeanaarlqssarrlaipelpeevfieslrq
liavdekwvppaggeeslylrpfviatepglgvrpsneyrylliaspagayfkggikpvs
vwlsheyvraspggtgaakfggnyaasllaqaqaaemgcdqvvwldaierryveemggmn
lffvfgsggsarlvtpelsgsllpgitrdsllqlatdagfaveerkidvdewqkkagage
itevfacgtaavitpvshvkhhdgeftiadgqpgeitmalrdtltgiqrgtfadthgwma
rln

SCOPe Domain Coordinates for d3dtga_:

Click to download the PDB-style file with coordinates for d3dtga_.
(The format of our PDB-style files is described here.)

Timeline for d3dtga_: