Lineage for d3dtfb_ (3dtf B:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2573070Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
    2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8
  4. 2573071Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) (S)
  5. 2573190Family e.17.1.0: automated matches [191499] (1 protein)
    not a true family
  6. 2573191Protein automated matches [190815] (19 species)
    not a true protein
  7. 2573235Species Mycobacterium smegmatis [TaxId:246196] [232034] (2 PDB entries)
  8. 2573238Domain d3dtfb_: 3dtf B: [232036]
    automated match to d2coib_
    complexed with gol, so4

Details for d3dtfb_

PDB Entry: 3dtf (more details), 2.2 Å

PDB Description: Structural analysis of mycobacterial branched chain aminotransferase- implications for inhibitor design
PDB Compounds: (B:) branched-chain amino acid aminotransferase

SCOPe Domain Sequences for d3dtfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dtfb_ e.17.1.0 (B:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
leftvsantnpatdavresilanpgfgkyytdhmvsidytvdegwhnaqvipygpiqldp
saivlhygqeifeglkayrwadgsivsfrpeanaarlqssarrlaipelpeevfieslrq
liavdekwvppaggeeslylrpfviatepglgvrpsneyrylliaspagayfkggikpvs
vwlsheyvraspggtgaakfggnyaasllaqaqaaemgcdqvvwldaierryveemggmn
lffvfgsggsarlvtpelsgsllpgitrdsllqlatdagfaveerkidvdewqkkagage
itevfacgtaavitpvshvkhhdgeftiadgqpgeitmalrdtltgiqrgtfadthgwma
rln

SCOPe Domain Coordinates for d3dtfb_:

Click to download the PDB-style file with coordinates for d3dtfb_.
(The format of our PDB-style files is described here.)

Timeline for d3dtfb_: