SCOPe 2.03: Domain d3dbxa2: 3dbx A:188-285

Lineage for d3dbxa2 (3dbx A:188-285)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [188287] (13 PDB entries)

8. Domain d3dbxa2: 3dbx A:188-285 [232033]
   Other proteins in same PDB: d3dbxa1, d3dbxb_
   automated match to d3jvga2
   complexed with nag, plm

Details for d3dbxa2

PDB Entry: 3dbx, 2 Å

PDB Description: structure of chicken cd1-2 with bound fatty acid

PDB Compounds: (A:) CD1-2 antigen

SCOPe Domain Sequences for d3dbxa2:

Sequence; same for both SEQRES and ATOM records:

>d3dbxa2 b.1.1.0 (A:188-285) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
rvppmavvfartagqvqlllvcrvtsfyprpiavtwlrdgrevppspalstgtvlpnadl
tyqlrstllvspqdghgyacrvqhcslgdrsllvpwhh

Timeline for d3dbxa2:

• d3dbxa2 is new in SCOPe 2.03-stable
  
• d3dbxa2 appears in SCOPe 2.04
  
• d3dbxa2 appears in the current release, SCOPe 2.08