SCOPe 2.08: Domain d3dl5d2: 3dl5 D:193-521

Lineage for d3dl5d2 (3dl5 D:193-521)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)

6. Protein automated matches [190469] (17 species)
   not a true protein

7. Species Cryptosporidium hominis [TaxId:237895] [232024] (3 PDB entries)

8. Domain d3dl5d2: 3dl5 D:193-521 [232026]
   Other proteins in same PDB: d3dl5a1, d3dl5b1, d3dl5c1, d3dl5d1, d3dl5e1
   automated match to d1qzfa2
   complexed with cb3, dhf, ndp, ump; mutant

Details for d3dl5d2

PDB Entry: 3dl5, 2.74 Å

PDB Description: crystal structure of the a287f active site mutant of ts-dhfr from cryptosporidium hominis

PDB Compounds: (D:) Dihydrofolate reductase, DHFR

SCOPe Domain Sequences for d3dl5d2:

Sequence; same for both SEQRES and ATOM records:

>d3dl5d2 d.117.1.1 (D:193-521) automated matches {Cryptosporidium hominis [TaxId: 237895]}
lksiddtvdllgeifgirkmgnrhkfpkeeiyntpsirfgrehyefqyldllsrvlenga
yrenrtgistysifgqmmrfdmresfpllttkkvfirsifeeliwfikgdtngnhliekk
vyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddytgvgvdqlakli
etlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnlyqrscdlglgsp
fniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrtprpfpqlkfkrk
veniedfkwedieligyypyptikmdmav

Timeline for d3dl5d2:

• d3dl5d2 first appeared in SCOPe 2.03
  
• d3dl5d2 appears in SCOPe 2.07