Lineage for d3dgeb2 (3dge B:321-481)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212981Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2212982Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2213473Family d.122.1.3: Histidine kinase [55884] (8 proteins)
  6. 2213520Protein automated matches [190839] (4 species)
    not a true protein
  7. 2213532Species Thermotoga maritima [TaxId:2336] [232020] (1 PDB entry)
  8. 2213533Domain d3dgeb2: 3dge B:321-481 [232021]
    Other proteins in same PDB: d3dgea1, d3dgeb1, d3dgec_, d3dged_
    automated match to d2c2aa2
    complexed with adp, cit, so4

Details for d3dgeb2

PDB Entry: 3dge (more details), 2.8 Å

PDB Description: Structure of a histidine kinase-response regulator complex reveals insights into Two-component signaling and a novel cis-autophosphorylation mechanism
PDB Compounds: (B:) Sensor protein

SCOPe Domain Sequences for d3dgeb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dgeb2 d.122.1.3 (B:321-481) automated matches {Thermotoga maritima [TaxId: 2336]}
qinrekvdlcdlvesavnaikefasshnvnvlfesnvpcpveayidptrirqvllnllnn
gvkyskkdapdkyvkvildekdggvliivedngigipdhakdrifeqfyrvdssltyevp
gtglglaitkeivelhggriwvesevgkgsrffvwipkdra

SCOPe Domain Coordinates for d3dgeb2:

Click to download the PDB-style file with coordinates for d3dgeb2.
(The format of our PDB-style files is described here.)

Timeline for d3dgeb2: