Class a: All alpha proteins [46456] (284 folds) |
Fold a.30: ROP-like [47379] (8 superfamilies) 4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist |
Superfamily a.30.2: Homodimeric domain of signal transducing histidine kinase [47384] (2 families) |
Family a.30.2.0: automated matches [227712] (1 protein) not a true family |
Protein automated matches [227713] (2 species) not a true protein |
Domain d3dgea1: 3dge A:245-320 [231992] Other proteins in same PDB: d3dgeb2, d3dgec_, d3dged_ automated match to d2c2aa1 |
PDB Entry: 3dge (more details), 2.8 Å
SCOPe Domain Sequences for d3dgea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dgea1 a.30.2.0 (A:245-320) automated matches {Thermotoga maritima [TaxId: 2336]} kridrmktefianishelrtpltaikayaetiynslgeldlstlkefleviidqsnhlen llnelldfsrlerksl
Timeline for d3dgea1:
View in 3D Domains from other chains: (mouse over for more information) d3dgeb1, d3dgeb2, d3dgec_, d3dged_ |