Lineage for d3deba_ (3deb A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1423492Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1423493Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1424465Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 1424466Protein automated matches [190805] (8 species)
    not a true protein
  7. 1424470Species Clostridium botulinum [TaxId:1491] [193827] (5 PDB entries)
  8. 1424473Domain d3deba_: 3deb A: [231989]
    automated match to d2qn0a_
    complexed with act, ca, fmt, na

Details for d3deba_

PDB Entry: 3deb (more details), 1.95 Å

PDB Description: Crystal Structure of apo form (Zinc removed) of the Botulinum Neurotoxin Type C Light Chain
PDB Compounds: (A:) Botulinum neurotoxin C1 light chain

SCOPe Domain Sequences for d3deba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3deba_ d.92.1.0 (A:) automated matches {Clostridium botulinum [TaxId: 1491]}
shmpitinnfnysdpvdnknilyldthlntlanepekafritgniwvipdrfsrnsnpnl
nkpprvtspksgyydpnylstdsdkdtflkeiiklfkrinsreigeeliyrlstdipfpg
nnntpintfdfdvdfnsvdvktrqgnnwvktgsinpsviitgpreniidpetstfkltnn
tfaaqegfgalsiisisprfmltysnatndvgegrfsksefcmdpililmhelnhamhnl
ygiaipndqtissvtsnifysqynvkleyaeiyafggptidlipksarkyfeekaldyyr
siakrlnsittanpssfnkyigeykqklirkyrfvvessgevtvnrnkfvelyneltqif
tefnyakiynvqnrkiylsnvytpvtanilddnvydiqngfnipksnlnvlfmgqnlsrn
palrkvnpenml

SCOPe Domain Coordinates for d3deba_:

Click to download the PDB-style file with coordinates for d3deba_.
(The format of our PDB-style files is described here.)

Timeline for d3deba_:

  • d3deba_ appears in periodic updates to SCOPe 2.03 starting on 2014-01-11
  • d3deba_ appears in SCOPe 2.04
  • d3deba_ appears in the current release, SCOPe 2.07, called d3deba1