SCOPe 2.04: Domain d3d9wd_: 3d9w D:

Lineage for d3d9wd_ (3d9w D:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.0: automated matches [191342] (1 protein)
   not a true family

6. Protein automated matches [190230] (16 species)
   not a true protein

7. Species Nocardia farcinica [TaxId:37329] [231965] (1 PDB entry)

8. Domain d3d9wd_: 3d9w D: [231969]
   automated match to d4guzd_

Details for d3d9wd_

PDB Entry: 3d9w, 2.7 Å

PDB Description: Crystal Structure Analysis of Nocardia farcinica Arylamine N-acetyltransferase

PDB Compounds: (D:) putative acetyltransferase

SCOPe Domain Sequences for d3d9wd_:

Sequence; same for both SEQRES and ATOM records:

>d3d9wd_ d.3.1.0 (D:) automated matches {Nocardia farcinica [TaxId: 37329]}
ddpayhwngaeldldaylarigfageraptlatlrelvyrhttaipfenleavlgrpvrl
dlatlqdklvhsrrggycyenaglfaaalerlgfgvtghtgrvtmgagglrpathallrv
ttadddrvwmcdvgfgrgplrpyelrpqpdeftlgdwrfrlerrtgelgtdlwvlhqfgr
dgwvdrytfttapqyridfevgnhfvstsprspfttrpflqrfhsdrhhvldgltliter
pdgsadiraltpgelpevinelfdielpgpdldalttgswl

Timeline for d3d9wd_:

• d3d9wd_ first appeared in SCOPe 2.03
  
• d3d9wd_ appears in SCOPe 2.05
  
• d3d9wd_ appears in the current release, SCOPe 2.08