Lineage for d3d9ga2 (3d9g A:261-431)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1731436Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1731940Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 1731941Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (10 proteins)
  6. 1732031Protein automated matches [231931] (2 species)
    not a true protein
  7. 1732032Species Fungus (Fusarium oxysporum) [TaxId:5507] [231932] (6 PDB entries)
  8. 1732041Domain d3d9ga2: 3d9g A:261-431 [231960]
    Other proteins in same PDB: d3d9ga1, d3d9gb1, d3d9gc1, d3d9gd1
    automated match to d2c0ua1
    complexed with cnx, fad, gol

Details for d3d9ga2

PDB Entry: 3d9g (more details), 2.15 Å

PDB Description: nitroalkane oxidase: wild type crystallized in a trapped state forming a cyanoadduct with fad
PDB Compounds: (A:) nitroalkane oxidase

SCOPe Domain Sequences for d3d9ga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d9ga2 a.29.3.1 (A:261-431) automated matches {Fungus (Fusarium oxysporum) [TaxId: 5507]}
pglkaqglvetafamsaalvgamaigtaraafeealvfaksdtrggskhiiehqsvadkl
idckirletsrllvwkavttledealewkvklemamqtkiyttdvavecvidamkavgmk
syakdmsfprllnevmcyplfdggniglrrrqmqrvmaledyepwaatygs

SCOPe Domain Coordinates for d3d9ga2:

Click to download the PDB-style file with coordinates for d3d9ga2.
(The format of our PDB-style files is described here.)

Timeline for d3d9ga2: