Class a: All alpha proteins [46456] (286 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (10 proteins) |
Protein automated matches [231931] (2 species) not a true protein |
Species Fungus (Fusarium oxysporum) [TaxId:5507] [231932] (6 PDB entries) |
Domain d3d9ga2: 3d9g A:261-431 [231960] Other proteins in same PDB: d3d9ga1, d3d9gb1, d3d9gc1, d3d9gd1 automated match to d2c0ua1 complexed with cnx, fad, gol |
PDB Entry: 3d9g (more details), 2.15 Å
SCOPe Domain Sequences for d3d9ga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d9ga2 a.29.3.1 (A:261-431) automated matches {Fungus (Fusarium oxysporum) [TaxId: 5507]} pglkaqglvetafamsaalvgamaigtaraafeealvfaksdtrggskhiiehqsvadkl idckirletsrllvwkavttledealewkvklemamqtkiyttdvavecvidamkavgmk syakdmsfprllnevmcyplfdggniglrrrqmqrvmaledyepwaatygs
Timeline for d3d9ga2: