SCOPe 2.08: Domain d3d9fc2: 3d9f C:261-431

Lineage for d3d9fc2 (3d9f C:261-431)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.0: automated matches [227204] (1 protein)
   not a true family

6. Protein automated matches [226935] (30 species)
   not a true protein

7. Species Fungus (Fusarium oxysporum) [TaxId:5507] [231947] (1 PDB entry)

8. Domain d3d9fc2: 3d9f C:261-431 [231954]
   Other proteins in same PDB: d3d9fa1, d3d9fb1, d3d9fc1, d3d9fd1
   automated match to d2c0ua1
   complexed with fad, gol, n6c; mutant

Details for d3d9fc2

PDB Entry: 3d9f, 2.2 Å

PDB Description: nitroalkane oxidase: active site mutant s276a crystallized with 1- nitrohexane

PDB Compounds: (C:) nitroalkane oxidase

SCOPe Domain Sequences for d3d9fc2:

Sequence; same for both SEQRES and ATOM records:

>d3d9fc2 a.29.3.0 (C:261-431) automated matches {Fungus (Fusarium oxysporum) [TaxId: 5507]}
pglkaqglvetafamaaalvgamaigtaraafeealvfaksdtrggskhiiehqsvadkl
idckirletsrllvwkavttledealewkvklemamqtkiyttdvavecvidamkavgmk
syakdmsfprllnevmcyplfdggniglrrrqmqrvmaledyepwaatygs

Timeline for d3d9fc2:

• d3d9fc2 first appeared in SCOPe 2.03
  
• d3d9fc2 appears in SCOPe 2.07