Class a: All alpha proteins [46456] (290 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
Family a.29.3.0: automated matches [227204] (1 protein) not a true family |
Protein automated matches [226935] (30 species) not a true protein |
Species Fungus (Fusarium oxysporum) [TaxId:5507] [231947] (1 PDB entry) |
Domain d3d9fa2: 3d9f A:261-432 [231948] Other proteins in same PDB: d3d9fa1, d3d9fb1, d3d9fc1, d3d9fd1 automated match to d2c0ua1 complexed with fad, gol, n6c; mutant |
PDB Entry: 3d9f (more details), 2.2 Å
SCOPe Domain Sequences for d3d9fa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d9fa2 a.29.3.0 (A:261-432) automated matches {Fungus (Fusarium oxysporum) [TaxId: 5507]} pglkaqglvetafamaaalvgamaigtaraafeealvfaksdtrggskhiiehqsvadkl idckirletsrllvwkavttledealewkvklemamqtkiyttdvavecvidamkavgmk syakdmsfprllnevmcyplfdggniglrrrqmqrvmaledyepwaatygss
Timeline for d3d9fa2: