SCOPe 2.05: Domain d3d9ec2: 3d9e C:261-431

Lineage for d3d9ec2 (3d9e C:261-431)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (10 proteins)

6. Protein automated matches [231931] (2 species)
   not a true protein

7. Species Fungus (Fusarium oxysporum) [TaxId:5507] [231932] (6 PDB entries)

8. Domain d3d9ec2: 3d9e C:261-431 [231945]
   Other proteins in same PDB: d3d9ea1, d3d9eb1, d3d9ec1, d3d9ed1
   automated match to d2c0ua1
   complexed with fad, gol, n8c; mutant

Details for d3d9ec2

PDB Entry: 3d9e, 2.2 Å

PDB Description: nitroalkane oxidase: active site mutant d402n crystallized with 1- nitrooctane

PDB Compounds: (C:) nitroalkane oxidase

SCOPe Domain Sequences for d3d9ec2:

Sequence; same for both SEQRES and ATOM records:

>d3d9ec2 a.29.3.1 (C:261-431) automated matches {Fungus (Fusarium oxysporum) [TaxId: 5507]}
pglkaqglvetafamsaalvgamaigtaraafeealvfaksdtrggskhiiehqsvadkl
idckirletsrllvwkavttledealewkvklemamqtkiyttdvavecvidamkavgmk
syakdmsfprllnevmcyplfnggniglrrrqmqrvmaledyepwaatygs

Timeline for d3d9ec2:

• d3d9ec2 first appeared in SCOPe 2.03
  
• d3d9ec2 appears in SCOPe 2.04
  
• d3d9ec2 appears in SCOPe 2.06
  
• d3d9ec2 appears in the current release, SCOPe 2.08