SCOPe 2.06: Domain d3d0sb2: 3d0s B:145-215

Lineage for d3d0sb2 (3d0s B:145-215)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (68 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [187939] (6 PDB entries)

8. Domain d3d0sb2: 3d0s B:145-215 [231922]
   Other proteins in same PDB: d3d0sa1, d3d0sb1, d3d0sb3
   automated match to d3r6sd2
   complexed with cl

Details for d3d0sb2

PDB Entry: 3d0s, 2 Å

PDB Description: camp receptor protein from m.tuberculosis, camp-free form

PDB Compounds: (B:) transcriptional regulatory protein

SCOPe Domain Sequences for d3d0sb2:

Sequence; same for both SEQRES and ATOM records:

>d3d0sb2 a.4.5.0 (B:145-215) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
dvpgrvakqllqlaqrfgtqeggalrvthdltqeeiaqlvgasretvnkaladfahrgwi
rlegksvlisd

Timeline for d3d0sb2:

• d3d0sb2 first appeared in SCOPe 2.03
  
• d3d0sb2 appears in SCOPe 2.05
  
• d3d0sb2 appears in SCOPe 2.07
  
• d3d0sb2 appears in the current release, SCOPe 2.08