Lineage for d3czua_ (3czu A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1776981Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1776982Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 1777799Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 1777800Protein automated matches [190770] (31 species)
    not a true protein
  7. 1777966Species Human (Homo sapiens) [TaxId:9606] [188939] (14 PDB entries)
  8. 1777993Domain d3czua_: 3czu A: [231917]
    Other proteins in same PDB: d3czub_
    automated match to d3etpa_

Details for d3czua_

PDB Entry: 3czu (more details), 2.65 Å

PDB Description: crystal structure of the human ephrin a2- ephrin a1 complex
PDB Compounds: (A:) Ephrin type-A receptor 2

SCOPe Domain Sequences for d3czua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3czua_ b.18.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kevvlldfaaaggelgwlthpygkgwdlmqnimndmpiymysvcnvmsgdqdnwlrtnwv
yrgeaerifielkftvrdcnsfpggasscketfnlyyaesdldygtnfqkrlftkidtia
pdeitvssdfearhvklnveersvgpltrkgfylafqdigacvallsvrvyykkc

SCOPe Domain Coordinates for d3czua_:

Click to download the PDB-style file with coordinates for d3czua_.
(The format of our PDB-style files is described here.)

Timeline for d3czua_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3czub_