Lineage for d3czmb1 (3czm B:15-163)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1829377Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 1829416Protein Lactate dehydrogenase [51859] (17 species)
  7. 1829619Species Toxoplasma gondii [TaxId:5811] [102166] (5 PDB entries)
  8. 1829634Domain d3czmb1: 3czm B:15-163 [231916]
    Other proteins in same PDB: d3czma2, d3czmb2
    automated match to d1pzga1
    complexed with nad, oxq

Details for d3czmb1

PDB Entry: 3czm (more details), 2.3 Å

PDB Description: t. gondii bradyzoite-specific ldh (ldh2) in complex with nad and oxq
PDB Compounds: (B:) l-lactate dehydrogenase

SCOPe Domain Sequences for d3czmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3czmb1 c.2.1.5 (B:15-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]}
gtvsrrkkiamigsgmiggtmgylcvlreladvvlfdvvtgmpegkalddsqatsiadtn
vsvtsanqyekiagsdvviitagltkvpgksdkewsrndllpfnakiirevaqgvkkycp
lafvivvtnpldcmvkcfheasglpknmvcgm

SCOPe Domain Coordinates for d3czmb1:

Click to download the PDB-style file with coordinates for d3czmb1.
(The format of our PDB-style files is described here.)

Timeline for d3czmb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3czmb2