SCOPe 2.04: Domain d3czmb1: 3czm B:15-163

Lineage for d3czmb1 (3czm B:15-163)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein Lactate dehydrogenase [51859] (18 species)

7. Species Toxoplasma gondii [TaxId:5811] [102166] (5 PDB entries)

8. Domain d3czmb1: 3czm B:15-163 [231916]
   Other proteins in same PDB: d3czma2, d3czmb2
   automated match to d1pzga1
   complexed with nad, oxq

Details for d3czmb1

PDB Entry: 3czm, 2.3 Å

PDB Description: t. gondii bradyzoite-specific ldh (ldh2) in complex with nad and oxq

PDB Compounds: (B:) l-lactate dehydrogenase

SCOPe Domain Sequences for d3czmb1:

Sequence; same for both SEQRES and ATOM records:

>d3czmb1 c.2.1.5 (B:15-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]}
gtvsrrkkiamigsgmiggtmgylcvlreladvvlfdvvtgmpegkalddsqatsiadtn
vsvtsanqyekiagsdvviitagltkvpgksdkewsrndllpfnakiirevaqgvkkycp
lafvivvtnpldcmvkcfheasglpknmvcgm

Timeline for d3czmb1:

• d3czmb1 first appeared in SCOPe 2.03
  
• d3czmb1 appears in SCOPe 2.05
  
• d3czmb1 appears in the current release, SCOPe 2.08