SCOPe 2.06: Domain d3cz5c_: 3cz5 C:

Lineage for d3cz5c_ (3cz5 C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (71 species)
   not a true protein

7. Species Aurantimonas sp. [TaxId:314269] [231910] (1 PDB entry)

8. Domain d3cz5c_: 3cz5 C: [231913]
   automated match to d4e7ob_
   complexed with po4

Details for d3cz5c_

PDB Entry: 3cz5, 2.7 Å

PDB Description: crystal structure of two-component response regulator, luxr family, from aurantimonas sp. si85-9a1

PDB Compounds: (C:) Two-component response regulator, LuxR family

SCOPe Domain Sequences for d3cz5c_:

Sequence; same for both SEQRES and ATOM records:

>d3cz5c_ c.23.1.0 (C:) automated matches {Aurantimonas sp. [TaxId: 314269]}
starimlvddhpivregyrrlierrpgyavvaeaadageayrlyrettpdivvmdltlpg
pggieatrhirqwdgaariliftmhqgsafalkafeagasgyvtkssdpaelvqaieail
agrramspdiaqeiaeervegr

Timeline for d3cz5c_:

• d3cz5c_ first appeared in SCOPe 2.03
  
• d3cz5c_ appears in SCOPe 2.05
  
• d3cz5c_ appears in SCOPe 2.07
  
• d3cz5c_ appears in the current release, SCOPe 2.08