Lineage for d1bdyb_ (1bdy B:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.7: C2 domain-like [49561] (4 superfamilies) Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (2 families) 
Family b.7.1.1: PLC-like (P variant) [49563] (5 proteins) Protein Domain from protein kinase C delta [49573] (1 species) Species Rat (Rattus norvegicus) [TaxId:10116] [49574] (1 PDB entry) 
Domain d1bdyb_: 1bdy B: [23191]
Details for d1bdyb_
PDB Entry: 1bdy (more details), 2.2 Å
PDB Description: c2 domain from protein kinase c delta
SCOP Domain Sequences for d1bdyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bdyb_ b.7.1.1 (B:) Domain from protein kinase C delta {Rat (Rattus norvegicus)}
mapflrisfnsyelgslqaeddasqpfcavkmkealttdrgktlvqkkptmypewkstfd
ahiyegrviqivlmraaedpmsevtvgvsvlaerckknngkaefwldlqpqakvlmcvqy
fle
SCOP Domain Coordinates for d1bdyb_:
Click to download the PDB-style file with coordinates for d1bdyb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bdyb_:
- d1bdyb_ appears in SCOP 1.57
- d1bdyb_ appears in the current release, SCOPe 2.08
View in 3D
