Lineage for d3cq5b_ (3cq5 B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1379866Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1379867Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1380996Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 1380997Protein automated matches [190151] (66 species)
    not a true protein
  7. 1381103Species Corynebacterium glutamicum [231893] (3 PDB entries)
  8. 1381105Domain d3cq5b_: 3cq5 B: [231895]
    automated match to d3hdoa_
    complexed with 144, pmp, so4

Details for d3cq5b_

PDB Entry: 3cq5 (more details), 1.8 Å

PDB Description: Histidinol-phosphate aminotransferase from Corynebacterium glutamicum in complex with PMP
PDB Compounds: (B:) Histidinol-phosphate aminotransferase

SCOPe Domain Sequences for d3cq5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cq5b_ c.67.1.0 (B:) automated matches {Corynebacterium glutamicum}
mtkitlsdlplreelrgehaygapqlnvdirlntnenpyppsealvadlvatvdkiatel
nryperdavelrdelaayitkqtgvavtrdnlwaangsneilqqllqafggpgrtalgfq
psysmhpilakgthtefiavsrgadfridmdvaleeirakqpdivfvttpnnptgdvtsl
ddveriinvapgivivdeayaefspspsattllekyptklvvsrtmskafdfaggrlgyf
vanpafidavmlvrlpyhlsalsqaaaivalrhsadtlgtveklsvervrvaarleelgy
avvpsesnfvffgdfsdqhaawqafldrgvlirdvgiaghlrttigvpeendafldaaae
iiklnl

SCOPe Domain Coordinates for d3cq5b_:

Click to download the PDB-style file with coordinates for d3cq5b_.
(The format of our PDB-style files is described here.)

Timeline for d3cq5b_: