SCOPe 2.07: Domain d3bzdb2: 3bzd B:117-235

Lineage for d3bzdb2 (3bzd B:117-235)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)

6. Protein Staphylococcal enterotoxin C3, SEC3 [54344] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [54345] (20 PDB entries)
   Uniprot P23313

8. Domain d3bzdb2: 3bzd B:117-235 [231874]
   Other proteins in same PDB: d3bzda_, d3bzdb1
   automated match to d1se4a2
   complexed with so4

Details for d3bzdb2

PDB Entry: 3bzd, 2.3 Å

PDB Description: Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex

PDB Compounds: (B:) Enterotoxin type C-3

SCOPe Domain Sequences for d3bzdb2:

Sequence; same for both SEQRES and ATOM records:

>d3bzdb2 d.15.6.1 (B:117-235) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
egnhfdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefns
spyetgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttk

Timeline for d3bzdb2:

• d3bzdb2 first appeared in SCOPe 2.03
  
• d3bzdb2 appears in SCOPe 2.06
  
• d3bzdb2 appears in the current release, SCOPe 2.08