SCOPe 2.03: Domain d3byyb2: 3byy B:117-235

Lineage for d3byyb2 (3byy B:117-235)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)

6. Protein automated matches [226944] (2 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [225595] (4 PDB entries)

8. Domain d3byyb2: 3byy B:117-235 [231873]
   Other proteins in same PDB: d3byya_, d3byyb1
   automated match to d1se4a2
   complexed with so4

Details for d3byyb2

PDB Entry: 3byy, 2.2 Å

PDB Description: Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex

PDB Compounds: (B:) Enterotoxin type C-3

SCOPe Domain Sequences for d3byyb2:

Sequence; same for both SEQRES and ATOM records:

>d3byyb2 d.15.6.1 (B:117-235) automated matches {Staphylococcus aureus [TaxId: 1280]}
egnhfdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefns
spyetgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttk

Timeline for d3byyb2:

• d3byyb2 is new in SCOPe 2.03-stable
  
• d3byyb2 appears in SCOPe 2.04
  
• d3byyb2 appears in the current release, SCOPe 2.08