![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) ![]() |
![]() | Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins) |
![]() | Protein automated matches [226992] (1 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:1280] [225594] (7 PDB entries) |
![]() | Domain d3bzdb1: 3bzd B:2-116 [231872] Other proteins in same PDB: d3bzda_, d3bzdb2 automated match to d3seba1 complexed with so4 |
PDB Entry: 3bzd (more details), 2.3 Å
SCOPe Domain Sequences for d3bzdb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bzdb1 b.40.2.2 (B:2-116) automated matches {Staphylococcus aureus [TaxId: 1280]} sqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkny dkvktellnedlakkykdevvdvygsnyyvncyfsskdnvwwhgktcmyggitkh
Timeline for d3bzdb1: