Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
Protein automated matches [190329] (9 species) not a true protein |
Species Agkistrodon rhodostoma [TaxId:8717] [188575] (1 PDB entry) |
Domain d3bx4b_: 3bx4 B: [231869] automated match to d2vrpb_ complexed with gol, so4 |
PDB Entry: 3bx4 (more details), 1.7 Å
SCOPe Domain Sequences for d3bx4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bx4b_ d.169.1.1 (B:) automated matches {Agkistrodon rhodostoma [TaxId: 8717]} cpsgwssyeghcykpfnepknwadaerfcklqpkhshlvsfqsaeeadfvvkltrprlka nlvwmglsniwhgcnwqwsdgarlnykdwqeqseclafrgvhtewlnmdcsstcsfvckf ka
Timeline for d3bx4b_: