Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (45 species) not a true protein |
Species Polaromonas sp. [TaxId:296591] [231856] (1 PDB entry) |
Domain d3bjsa2: 3bjs A:166-410 [231857] Other proteins in same PDB: d3bjsa1, d3bjsb1 automated match to d2o56a2 complexed with mg |
PDB Entry: 3bjs (more details), 2.7 Å
SCOPe Domain Sequences for d3bjsa2:
Sequence, based on SEQRES records: (download)
>d3bjsa2 c.1.11.0 (A:166-410) automated matches {Polaromonas sp. [TaxId: 296591]} skrripayaggialgyqpkeslaeeaqeyiargykalklrigdaarvdiervrhvrkvlg devdiltdantaytmadarrvlpvlaeiqagwleepfacndfasyrevakitplvpiaag enhytrfefgqmldagavqvwqpdlskcggitegiriaamasayripinahssatglnha atihflaatenagyfeacvskfnpfrdmfgtsfeigadgcveppdapglgievdesifek ypavd
>d3bjsa2 c.1.11.0 (A:166-410) automated matches {Polaromonas sp. [TaxId: 296591]} skrripayaggialgyqpkeslaeeaqeyiargykalklrigdaarvdiervrhvrkvlg devdiltdantaytmadarrvlpvlaeiqagwleepfacndfasyrevakitplvpiaag enhytrfefgqmldagavqvwqpdlskcggitegiriaamasayripinahssatglnha atihflaatenagyfeacvskfnpfrdmfgtfeigadgcveppdapglgievdesifeky pavd
Timeline for d3bjsa2: