Lineage for d3bjsa1 (3bjs A:37-165)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948437Species Polaromonas sp. [TaxId:296591] [231854] (1 PDB entry)
  8. 2948438Domain d3bjsa1: 3bjs A:37-165 [231855]
    Other proteins in same PDB: d3bjsa2, d3bjsb2
    automated match to d2o56a1
    complexed with mg

Details for d3bjsa1

PDB Entry: 3bjs (more details), 2.7 Å

PDB Description: crystal structure of a member of enolase superfamily from polaromonas sp. js666
PDB Compounds: (A:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d3bjsa1:

Sequence, based on SEQRES records: (download)

>d3bjsa1 d.54.1.0 (A:37-165) automated matches {Polaromonas sp. [TaxId: 296591]}
mkitkinaiplsyrlpegktvtmgvgstikrdaiiirvetsegitgygeahpgrspgait
slihntiapmligmkatdcvgawqrvhrmqlsshglgagaalaisgidmalwdirgkaan
mplyellgg

Sequence, based on observed residues (ATOM records): (download)

>d3bjsa1 d.54.1.0 (A:37-165) automated matches {Polaromonas sp. [TaxId: 296591]}
mkitkinaiplsyrlptvtmgvgstikrdaiiirvetsegitgygeahpgrspgaitsli
hntiapmligmkatdcvgawqrvhrmqlsshglgagaalaisgidmalwdirgkaanmpl
yellgg

SCOPe Domain Coordinates for d3bjsa1:

Click to download the PDB-style file with coordinates for d3bjsa1.
(The format of our PDB-style files is described here.)

Timeline for d3bjsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3bjsa2