Lineage for d3biax_ (3bia X:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2369776Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)
  8. 2370105Domain d3biax_: 3bia X: [231850]
    automated match to d2oypa_
    complexed with na, tla

Details for d3biax_

PDB Entry: 3bia (more details), 2.2 Å

PDB Description: Tim-4 in complex with sodium potassium tartrate
PDB Compounds: (X:) T-cell immunoglobulin and mucin domain-containing protein 4

SCOPe Domain Sequences for d3biax_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3biax_ b.1.1.0 (X:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
edtiigflgqpvtlpchylswsqsrnsmcwgkgscpnskcnaellrtdgtriisrkstky
tllgkvqfgevsltisntnrgdsgvyccrievpgwfndvkknvrlelrra

SCOPe Domain Coordinates for d3biax_:

Click to download the PDB-style file with coordinates for d3biax_.
(The format of our PDB-style files is described here.)

Timeline for d3biax_: