SCOPe 2.07: Domain d3bi9x1: 3bi9 X:1-112

Lineage for d3bi9x1 (3bi9 X:1-112)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)

8. Domain d3bi9x1: 3bi9 X:1-112 [231849]
   Other proteins in same PDB: d3bi9x2
   automated match to d2oypa_
   complexed with act

Details for d3bi9x1

PDB Entry: 3bi9, 2.95 Å

PDB Description: Tim-4

PDB Compounds: (X:) T-cell immunoglobulin and mucin domain-containing protein 4

SCOPe Domain Sequences for d3bi9x1:

Sequence; same for both SEQRES and ATOM records:

>d3bi9x1 b.1.1.0 (X:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
msedtiigflgqpvtlpchylswsqsrnsmcwgkgscpnskcnaellrtdgtriisrkst
kytllgkvqfgevsltisntnrgdsgvyccrievpgwfndvkknvrlelrra

Timeline for d3bi9x1:

• d3bi9x1 first appeared in SCOPe 2.03, called d3bi9x_
  
• d3bi9x1 appears in SCOPe 2.06
  
• d3bi9x1 appears in the current release, SCOPe 2.08