Lineage for d3bi9x_ (3bi9 X:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1297218Species Mus musculus [TaxId:10090] [227304] (35 PDB entries)
  8. 1297274Domain d3bi9x_: 3bi9 X: [231849]
    automated match to d2oypa_
    complexed with act

Details for d3bi9x_

PDB Entry: 3bi9 (more details), 2.95 Å

PDB Description: Tim-4
PDB Compounds: (X:) T-cell immunoglobulin and mucin domain-containing protein 4

SCOPe Domain Sequences for d3bi9x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bi9x_ b.1.1.0 (X:) automated matches {Mus musculus [TaxId: 10090]}
msedtiigflgqpvtlpchylswsqsrnsmcwgkgscpnskcnaellrtdgtriisrkst
kytllgkvqfgevsltisntnrgdsgvyccrievpgwfndvkknvrlelrralv

SCOPe Domain Coordinates for d3bi9x_:

Click to download the PDB-style file with coordinates for d3bi9x_.
(The format of our PDB-style files is described here.)

Timeline for d3bi9x_:

  • d3bi9x_ appears in periodic updates to SCOPe 2.03 starting on 2014-01-11
  • d3bi9x_ appears in SCOPe 2.04
  • d3bi9x_ appears in the current release, SCOPe 2.07, called d3bi9x1