SCOPe 2.05: Domain d3bdbe_: 3bdb E:

Lineage for d3bdbe_ (3bdb E:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Ictalurus punctatus [TaxId:7998] [225469] (6 PDB entries)

8. Domain d3bdbe_: 3bdb E: [231843]
   automated match to d2qqqb_

Details for d3bdbe_

PDB Entry: 3bdb, 2.8 Å

PDB Description: crystal structure of novel immune-type receptor 11 extracellular fragment from ictalurus punctatus including stalk region

PDB Compounds: (E:) Novel immune-type receptor 11

SCOPe Domain Sequences for d3bdbe_:

Sequence; same for both SEQRES and ATOM records:

>d3bdbe_ b.1.1.0 (E:) automated matches {Ictalurus punctatus [TaxId: 7998]}
ikelhvktvkrgenvtmecsmskvtnknnlawyrqsfgkvpqyfvryyssnsgykfaegf
kdsrfsmtvndqkfdlniigareddggeyfcgevegiiikftsgtrlqfegsnegskssd
gegssc

Timeline for d3bdbe_:

• d3bdbe_ first appeared in SCOPe 2.03
  
• d3bdbe_ appears in SCOPe 2.04
  
• d3bdbe_ appears in SCOPe 2.06
  
• d3bdbe_ appears in the current release, SCOPe 2.08